PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan015673
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family HB-other
Protein Properties Length: 218aa    MW: 24338.1 Da    PI: 9.0853
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-73200PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.2e-182075257
               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                kR   t++ql +Le++F++++yps++++ e A+++gL+e+qV+ WF+ rR k+k+
  Aan015673 20 PKRIHKTPKQLIALENFFNEHKYPSEAMKLEVAESIGLSEKQVSGWFCHRRLKDKN 75
               689999***********************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.1311676IPR001356Homeobox domain
SMARTSM003893.6E-181880IPR001356Homeobox domain
SuperFamilySSF466892.69E-171881IPR009057Homeodomain-like
PfamPF000461.4E-152074IPR001356Homeobox domain
CDDcd000862.62E-162177No hitNo description
Gene3DG3DSA:1.10.10.608.3E-192175IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MEEPQGVRAY ENGALLDKKP KRIHKTPKQL IALENFFNEH KYPSEAMKLE VAESIGLSEK  60
QVSGWFCHRR LKDKNKSPND EIQTHGKQDR SSGVIQDRGS GLRQDSCGST KQGDNKHFEP  120
KEVESRRFTA GDLFPTEVPF DHVNQHNNNM HMDDDTSSGS SSPLKDKFHP QNVDRLGTLT  180
SIYPTHSDVK SVKGRTGPSG FLKVKGQVEN AAITAVKG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004252889.14e-71PREDICTED: uncharacterized protein LOC101256269
RefseqXP_015059288.14e-71PREDICTED: uncharacterized protein LOC107005262
TrEMBLA0A118K4X91e-109A0A118K4X9_CYNCS; Homeodomain-containing protein
STRINGSolyc12g099760.1.11e-70(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.15e-47HB-other family protein